PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c12_22500V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MIKC_MADS
Protein Properties Length: 355aa    MW: 38658.8 Da    PI: 9.1857
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c12_22500V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.85.9e-2880130151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                         k+ien++ rqvtfskRr g+lKKA+EL vLCdaeva++ifsstgkl+ey+s
  Pp3c12_22500V3.1.p  80 KKIENTTSRQVTFSKRRGGLLKKAHELAVLCDAEVALVIFSSTGKLFEYAS 130
                         68***********************************************86 PP

2K-box84.81.9e-28150240999
               K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                         ++ a +  l +e+ kL++++e L+++qR++lGedL+ L++ +L qLeqqL+ + +++R++Kn+l+le+ie lqkke+el  +n++Lrkk++
  Pp3c12_22500V3.1.p 150 KSGASTDFLGREVVKLQEQVERLKSSQRRMLGEDLSALKVPDLLQLEQQLDLGASRVRARKNQLILEEIEGLQKKEQELMVANEDLRKKIA 240
                         55667788899******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.88472132IPR002100Transcription factor, MADS-box
SMARTSM004327.5E-4272131IPR002100Transcription factor, MADS-box
CDDcd002651.28E-4373147No hitNo description
SuperFamilySSF554551.26E-3273146IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-307494IPR002100Transcription factor, MADS-box
PROSITE patternPS00350074128IPR002100Transcription factor, MADS-box
PfamPF003191.5E-2581128IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-3094109IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-30109130IPR002100Transcription factor, MADS-box
PfamPF014863.7E-24155239IPR002487Transcription factor, K-box
PROSITE profilePS5129715.194155245IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048283Biological Processindeterminate inflorescence morphogenesis
GO:0048481Biological Processplant ovule development
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MMTAACGQPS KQWQFGAVAP TAATATGTAA QELSGGEILD GDCEVPTCLS LGVSSGKGDS  60
STESTRRKGG VMGRGKIEIK KIENTTSRQV TFSKRRGGLL KKAHELAVLC DAEVALVIFS  120
STGKLFEYAS SGSMRDIIER YKKSPNGAMK SGASTDFLGR EVVKLQEQVE RLKSSQRRML  180
GEDLSALKVP DLLQLEQQLD LGASRVRARK NQLILEEIEG LQKKEQELMV ANEDLRKKIA  240
DAEAVARANL SEARPESPRH LARTLSRDVS ASSHPAATVY PHPNLRDVQR SQTSLQLGMF  300
SSESYPPSSS RWPSEQQFPS ASEGCAGESS MKWDHPHYHI QNRLHANILP SVRI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A2e-1973141168Myocyte-specific enhancer factor 2A
3mu6_B2e-1973141168Myocyte-specific enhancer factor 2A
3mu6_C2e-1973141168Myocyte-specific enhancer factor 2A
3mu6_D2e-1973141168Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.136270.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1509310.0AF150931.1 Physcomitrella patens MADS-domain protein PPM1 (ppm1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001769862.10.0MIKCC MADS-domain protein PPM1
TrEMBLQ7FZQ70.0Q7FZQ7_PHYPA; MADS-domain protein PPM1
STRINGPP1S118_209V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.17e-52MIKC_MADS family protein